Protein coding transcript 131576

• Transcript: Ll_transcript_140039
• CDS coordinates: 60-371 (+)
• Peptide sequence: MEAYKFMIVVAIMSMIGSGSMMVNGQSFCHMSKAGLKSCLPSVSGENPVPPTPTCCLAIANADLACLCQYKDSSLLKSIYGVDPNLAMALPVKCNVVDPSFHC*
• ORF Type: complete

Annotations of Ll_transcript_140039

• Blastp: Putative lipid-transfer protein DIR1 from Arabidopsis with 50.7% of identity
• Blastx: Putative lipid-transfer protein DIR1 from Arabidopsis with 50.7% of identity
• Eggnog: Lipid-transfer protein(ENOG410YXDY)
• Kegg: Link to kegg annotations (AT5G48485)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412702.1)
• Pfam: Probable lipid transfer (PF14368.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;