Protein coding transcript 131592

• Transcript: Ll_transcript_170086
• CDS coordinates: 356-1294 (+)
• Peptide sequence: MKSLLPSTTSLLPPPSAFLPHQSHGFLHMASPTSFNFSNKERRSLSDDGPIETAPKIELKPPPYPLNALEPIISQKTLEYHWGKHHRAYVDNLNKQIAGTDLEGKSLEEIIVTSYNKGDILPAFNNAAQAWNHEFYWESIKPGGGGKPSGDLLKQIERDFGSFEKLIDELKIAATTQFGSGWAWLAYKENRLDVGNAVNPLASEADKKLVVVKSPNAVNPLVWGYYPILTIDVWEHAYYLDFQNRRPDYISNFIEKLVSWEAVSSRLEQAKVLIAEKEKEDERKKREEEEELLTGGSRSQTYRYSDAEGIIE*
• ORF Type: complete

Annotations of Ll_transcript_170086

• Blastp: Superoxide dismutase [Fe] 2, chloroplastic from Arabidopsis with 69.4% of identity
• Blastx: Superoxide dismutase [Fe], chloroplastic from Soja with 74.57% of identity
• Eggnog: Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity)(COG0605)
• Kegg: Link to kegg annotations (AT5G51100)
• CantataDB: Link to cantataDB annotations (CNT0001139)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435587.1)
• Pfam: Iron/manganese superoxide dismutases, alpha-hairpin domain (PF00081.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;