Protein coding transcript 131613

• Transcript: Ll_transcript_170088
• CDS coordinates: 92-685 (+)
• Peptide sequence: MVIDAVAGSSSSSSYHRSHPRKKRTTMMTMLHDNNNNSNNNVVKTSKYGSGKKQADTGAPKITPPCTECGKKFWSWKALFGHMRCHPERQWRGINPPPNVTPRQSQILTDEDHEVAASLLLLAKGKGKVIVKEDTMINVNYGILSPNLSLVSSQEERFVCSCCNKVFGSHQALGGHRASHKNVKGCFAINVGEDNMNI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_170088

• Blastp: Zinc finger protein ZAT3 from Arabidopsis with 49.5% of identity
• Blastx: Zinc finger protein ZAT3 from Arabidopsis with 45.34% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT4G35280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436593.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;