Protein coding transcript 131623

• Transcript: Ll_transcript_247428
• CDS coordinates: 1-519 (+)
• Peptide sequence: QKVKSVLVDDKKHIRFADWDVKDIEVLNKYLFLTSKPALYLVNLTEKDYIKKKNKWLIKIKEWVDKQDPGSLIIPFSGAFEQKLVDDFKDDPAGRKKYLEDNGTTSALDKIVVQGYKSLQLEYFFTSGADEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMKFVDFKEEG
• ORF Type: internal

Annotations of Ll_transcript_247428

• Blastp: Obg-like ATPase 1 from Sophophora with 70.35% of identity
• Blastx: Obg-like ATPase 1 from Sophophora with 70.35% of identity
• Eggnog: gtp-binding protein(COG0012)
• Kegg: Link to kegg annotations (Dmel_CG1354)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003546267.1)
• Pfam: Protein of unknown function (DUF933) (PF06071.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;