Protein coding transcript 131643

• Transcript: Ll_transcript_107953
• CDS coordinates: 3-626 (+)
• Peptide sequence: FYDSFVNIYTAPSLQKTWYTVLGNHDYRGVVEAQLSPLQRKKDRRWVCLRSFILDAEIVEFFFVDTTPFVNKYFDSKKVAYDWKGVLPRGPYLSNLLKDVDSALAKSKAQWKIVVGHHTIKTAGLHGNTVELEDKLVPILKKNNVAAYINGHDHCLEHIIDQKSGIHYLTSGGGSKAWRGEIKKLDPQELKLYYDGQGFLSVQITKTK
• ORF Type: internal

Annotations of Ll_transcript_107953

• Blastp: Purple acid phosphatase 8 from Arabidopsis with 65.55% of identity
• Blastx: Purple acid phosphatase 8 from Arabidopsis with 65.55% of identity
• Eggnog: Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409)
• Kegg: Link to kegg annotations (AT2G01890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464432.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;