Protein coding transcript 131652

• Transcript: Ll_transcript_107978
• CDS coordinates: 1-378 (+)
• Peptide sequence: EKDKKIEGYNTKEDSGIMRDPMNITSLRVPVLKSMELMVEASPRRVFANAHTYHINSISVNSDQETYLSDDDLRINLWNLEITDQSFNIVDIKPTNMEELTEVITAAEFHPLECNLFVYSSSKGTI
• ORF Type: internal

Annotations of Ll_transcript_107978

• Blastp: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform from Silurana with 82.54% of identity
• Blastx: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform from Silurana with 82.54% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (448324)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004486807.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;