Protein coding transcript 131658

• Transcript: Ll_transcript_107904
• CDS coordinates: 2-1150 (+)
• Peptide sequence: LSIFNSMSMWSNLPFDLLANIYSFLSLDSLARARSSCKNWHACSKSYPLTPTTSSTKSKSWFLALPIHIHHRPCCYAQNPFMGTWHNLSMEFLPISAVKPVASIGGHILLRVTNSTMFQLALCNPFTRDFRYLPRLNFSRTNPAVGLVVLDSNNDIQYQFHHFRVYVSGGMSKAAKDYGANFEATTEMYDSKLKTWQIVGSMPMEIAIRLTVWTPNENVCVNETLYWVTSARVYSMMRFDIGTTKWNVLSVPMADRLEFATLVKWNGALALVGGTFSDGACIWEMNEGGIWCLVEKVPVELGLKLLSGKRNWDSVKCVGNEDSIILFRDLVSGMVACKKVGDKGTWEWFWVDGCGYIKGKHVPNCAIRGTLVYPNLVSSLIF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_107904

• Blastp: F-box only protein 6 from Arabidopsis with 26.1% of identity
• Blastx: F-box only protein 6 from Arabidopsis with 25.69% of identity
• Eggnog: f-box only protein(ENOG4111JVR)
• Kegg: Link to kegg annotations (AT1G27340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429991.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;