Transcript | Ll_transcript_107904 |
---|---|
CDS coordinates | 2-1150 (+) |
Peptide sequence | LSIFNSMSMWSNLPFDLLANIYSFLSLDSLARARSSCKNWHACSKSYPLTPTTSSTKSKSWFLALPIHIHHRPCCYAQNPFMGTWHNLSMEFLPISAVKPVASIGGHILLRVTNSTMFQLALCNPFTRDFRYLPRLNFSRTNPAVGLVVLDSNNDIQYQFHHFRVYVSGGMSKAAKDYGANFEATTEMYDSKLKTWQIVGSMPMEIAIRLTVWTPNENVCVNETLYWVTSARVYSMMRFDIGTTKWNVLSVPMADRLEFATLVKWNGALALVGGTFSDGACIWEMNEGGIWCLVEKVPVELGLKLLSGKRNWDSVKCVGNEDSIILFRDLVSGMVACKKVGDKGTWEWFWVDGCGYIKGKHVPNCAIRGTLVYPNLVSSLIF* |
ORF Type | 5prime_partial |
Blastp | F-box only protein 6 from Arabidopsis with 26.1% of identity |
---|---|
Blastx | F-box only protein 6 from Arabidopsis with 25.69% of identity |
Eggnog | f-box only protein(ENOG4111JVR) |
Kegg | Link to kegg annotations (AT1G27340) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429991.1) |
Pfam | F-box domain (PF00646.32) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer