Protein coding transcript 131659

• Transcript: Ll_transcript_107966
• CDS coordinates: 162-617 (+)
• Peptide sequence: MHSLYFILLILIIIKSNHAADPSSIRGNKLVDEIVNLVHEDWIVIQKEVSVQVSEFKERLSCLRFGEAVELVCCLKRLEECKEKMMLEMAQGHRFWDLVREVKDKTGTEVYKEKGKVQKEIRKERVSESDRFCSRVLISADSFQFPSGRLF*
• ORF Type: complete

Annotations of Ll_transcript_107966

• Blastp: Putative clathrin assembly protein At4g40080 from Arabidopsis with 38.24% of identity
• Blastx: Putative clathrin assembly protein At4g40080 from Arabidopsis with 37.04% of identity
• Eggnog: Clathrin assembly protein(ENOG410XQ90)
• Kegg: Link to kegg annotations (AT4G40080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462677.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;