Protein coding transcript 131666

• Transcript: Ll_transcript_107929
• CDS coordinates: 1-348 (-)
• Peptide sequence: PLVCRPLMFLVIKHTPEGRPVKNAFIYIIVAMVLLLGWLSVYINQDFVLGAFILGLSVPEGPPLGSAFVKKLHFFGSWFLLPIFVTTSVMRVDLFMEYPHGMVIAISSIVLFIHIA
• ORF Type: internal

Annotations of Ll_transcript_107929

• Blastp: Cation/H(+) antiporter 4 from Arabidopsis with 49.45% of identity
• Blastx: Cation/H(+) antiporter 4 from Arabidopsis with 49.45% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT3G44900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416337.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;