Protein coding transcript 131668

• Transcript: Ll_transcript_107993
• CDS coordinates: 40-333 (+)
• Peptide sequence: MTGDGTTSTVLLIGELLKQADLFIAEGLHPRILTEGFEQARKKAVEVLDSMKIPTEAKRESLIDVARTSLATKVHPKLAAVLAGVCVDAVLAIRQDKK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_107993

• Blastp: T-complex protein 1 subunit zeta-2 from Mus with 68.42% of identity
• Blastx: T-complex protein 1 subunit zeta-2 from Bos with 70.37% of identity
• Eggnog: t-complex protein 1 subunit(ENOG410XQ3Q)
• Kegg: Link to kegg annotations (12467)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013447808.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;