Protein coding transcript 131679

• Transcript: Ll_transcript_107928
• CDS coordinates: 1-429 (+)
• Peptide sequence: RASLTPGTVCIILAGRHAGKHVVLLKVLKSGLCLITGPFRVNACPMRRVHQNFLIATSTKLDISSVNVPEKLNDDYFKRKRDKRAKKEEGEIFAKKAEGYTCSEERKKDQMDIDKQIYAVLKKHPERRMMTKYLRSMFGLKTN
• ORF Type: internal

Annotations of Ll_transcript_107928

• Blastp: 60S ribosomal protein L6 from Chinchilla with 55% of identity
• Blastx: 60S ribosomal protein L6 from Chinchilla with 55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004504017.1)
• Pfam: Ribosomal protein L6e (PF01159.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;