Protein coding transcript 131682

• Transcript: Ll_transcript_107982
• CDS coordinates: 3-788 (+)
• Peptide sequence: DGGVIAHGVTGTKESKILSYISTPRPWQQTLYFSRHGESEFNVVGKIGGDAPLSPRGRLYSQCLAKHIHALKIPSLQVWTSTLQRTRATSANIQAPQQHLHELDEIFSGDCEGFTYEDLQEHFPKELALRDKEKLKYRYPRGESYIDVTQRLIPVLTQLECETNVLTVSHQAVLRCILGYFLETPPDEIPYVHVPLHTIIKITLQGFNYNMETVKMPIDCVDTNRAKPTNCSESRTKEDVFKTIPAHFDSVAAIQNLNLCT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_107982

• Blastp: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase from Aquarana with 45.11% of identity
• Blastx: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase from Aquarana with 45.11% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017428638.1)
• Pfam: Histidine phosphatase superfamily (branch 1) (PF00300.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;