Protein coding transcript 131688

• Transcript: Ll_transcript_107932
• CDS coordinates: 68-709 (+)
• Peptide sequence: MLFGLFIFYSDMPRALVAPDTDNVNGTWGHEHNNMSVLQQHVAFFDLDKDGIIYPWETFRAFRSMGFNVISSSVLTILLHAALSYATLPTWLPSPVFPIYIQNIHRAKHGGDSGTYDTEGRFTPANFEFIFSKYAREVPDKLTLRELWHMTQANSVAHDYFGWAASKLEWGVLYILARDEQGFLSKEAVRRCFDGSLFEYCAKLRKGTAGKMA*
• ORF Type: complete

Annotations of Ll_transcript_107932

• Blastp: Peroxygenase from Sesamum with 67.16% of identity
• Blastx: Peroxygenase from Sesamum with 67.16% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (105171741)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451481.1)
• Pfam: Caleosin related protein (PF05042.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;