Protein coding transcript 131689

• Transcript: Ll_transcript_107933
• CDS coordinates: 155-805 (+)
• Peptide sequence: MAKAQASQEAMSTVADMAPITADRNLPQDLDSKLSKPYMPRALVAPDTDNVNGTWGHEHNNMSVLQQHVAFFDLDKDGIIYPWETFRAFRSMGFNVISSSVLTILLHAALSYATLPTWLPSPVFPIYIQNIHRAKHGGDSGTYDTEGRFTPANFEFIFSKYAREVPDKLTLRELWHMTQANSVAHDYFGWFFLLLFLHVVCIHNYTTYRDIRLYVV*
• ORF Type: complete

Annotations of Ll_transcript_107933

• Blastp: Peroxygenase 2 from Arabidopsis with 61.5% of identity
• Blastx: Peroxygenase 2 from Arabidopsis with 56.23% of identity
• Eggnog: Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination and in the oxylipin signaling pathways and plant defense responses. Can catalyze sulfoxidation of thiobenzamide, hydroxylation of aniline(ENOG4111R51)
• Kegg: Link to kegg annotations (AT5G55240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451481.1)
• Pfam: Caleosin related protein (PF05042.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;