Protein coding transcript 131691

• Transcript: Ll_transcript_107934
• CDS coordinates: 153-1088 (+)
• Peptide sequence: MCDTAVPPQYPICETDNGGHKKCIILPKKNSLTTLEGRLETFKTWPNKEVDPRKLAEAGFYYTKHEDIVRCPFCFVEGYRWQAEDNPMDDHLRWTREQRRQCTFVSDRRSEHDDAVSEDSTNGRDTCGKYGVEILPCSIPEDKNVNLEKLGVTKVKGPAHPEYVLQQSRLESFKQWPKSLRQKPEDLASAGFFYLGCGDQVLCFHCGGGLKDWEENDEPWEQHGMWFPKCSYLLLKKGVEYVNKLKEETRETEDITLPSTSGSLNTVETKVPQSTTVSEIKSDSDKNNEKSSEQDHHLCKICFKNELGVVFL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_107934

• Blastp: Apoptosis inhibitor IAP from Betabaculovirus with 39.22% of identity
• Blastx: Apoptosis inhibitor IAP from Betabaculovirus with 38.87% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (921387)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020223339.1)
• Pfam: Inhibitor of Apoptosis domain (PF00653.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;