| Transcript | Ll_transcript_107962 |
|---|---|
| CDS coordinates | 1-378 (+) |
| Peptide sequence | EKAKLLSALGCSSETWLLNRYLNWSLDSSIIRKQDAATVFYSVASSDIGFYVAKDFLYRKIADISEYYQPRGDRVGRYVKVIGSQMKTKEELDEIQSFINKSSAYLKGADLTINQTIETVKINTEW |
| ORF Type | internal |
| Blastp | Aminopeptidase N from Sus with 32.28% of identity |
|---|---|
| Blastx | Aminopeptidase N from Sus with 32.28% of identity |
| Eggnog | aminopeptidase(COG0308) |
| Kegg | Link to kegg annotations (397520) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014501580.1) |
| Pfam | ERAP1-like C-terminal domain (PF11838.7) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer