Protein coding transcript 131693

• Transcript: Ll_transcript_107965
• CDS coordinates: 3-374 (+)
• Peptide sequence: KIKTKSNQTKPVMDKDGSKGRDKDDSRDVRYRGVRCRPWGKFAAEIRDSARQGQRVWLGTFNTAEEAARAYDRAAYAMRGSFAILNFPHEYPMSGASAGSHSSAASSSSSRHGNVEGREVFEIE
• ORF Type: internal

Annotations of Ll_transcript_107965

• Blastp: Ethylene-responsive transcription factor ERF096 from Arabidopsis with 65.26% of identity
• Blastx: Ethylene-responsive transcription factor ERF095 from Arabidopsis with 81.54% of identity
• Eggnog: Transcription factor(ENOG410ZN2I)
• Kegg: Link to kegg annotations (AT5G43410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427390.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;