Protein coding transcript 131696

• Transcript: Ll_transcript_46080
• CDS coordinates: 40-825 (+)
• Peptide sequence: MTTLSPRQAQREHVLAVSRDFVSQPRLTYKTVSGVNGPLVILEDVKFPKFYEIVQLKLADGSIRSGQVLEVSGSKAVVQVFEGTSGIDAKHTVCEFTGDILRTSVSEDMLGRVFNGSGKPIDKGPPILAEDFLDIQGQPINPWSRIYPEEMIQTGITAIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKVPGKSVLDDHEDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITPRLAL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_46080

• Blastp: V-type proton ATPase subunit B from Manduca with 94.23% of identity
• Blastx: V-type proton ATPase subunit B from Manduca with 94.23% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014513828.1)
• Pfam: ATP synthase alpha/beta family, beta-barrel domain (PF02874.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;