Protein coding transcript 1317

• Transcript: Ll_transcript_358546
• CDS coordinates: 34-684 (+)
• Peptide sequence: MASIPLLRHSFRPTATVFHRKPSSTSPLTLFPTPIFSPLPLPLPLTRTGGVITRMSKKYSSSSPPSTERLISVVAYCLPFMNSLQYSRFLLSQYPKLSLLLEPVIPFLSLYRSIPYASFVAFFALYLGLVRNPNINRYVRFNAMQAVTLDVLLVLPVLMQRIFAPGRVGLGFKVMVWSHNFIFLFAVFCFLYSAVSCVLGRTPYLPFVADAASRQI*
• ORF Type: complete

Annotations of Ll_transcript_358546

• Blastp: Protein TIC 20-II, chloroplastic from Arabidopsis with 55.28% of identity
• Blastx: Protein TIC 20-II, chloroplastic from Arabidopsis with 64.9% of identity
• Eggnog: protein transport(ENOG4111UMD)
• Kegg: Link to kegg annotations (AT2G47840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434225.1)
• Pfam: Chloroplast import apparatus Tic20-like (PF16166.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;