Protein coding transcript 131701

• Transcript: Ll_transcript_46071
• CDS coordinates: 2-643 (+)
• Peptide sequence: IEGECRIGGQEQFYLETQACLAVPKPEDGEMEVYSSTQNPTEVGKLIAEILGVQQNKIFCKVKRLGGGFGGKESKAAMLALPVCAAANKLNRPIRCMLDRDEDIIMTGARHPFKFTYKVAFDNKGKILGCDIQCYNNCGYAVDLSLSVLERAMTHFENAYSIPVVRVTGYPCKTNLPSNTAFRGFGGPQGMYAAECILQDIADYLKKDPFEISE
• ORF Type: internal

Annotations of Ll_transcript_46071

• Blastp: Xanthine dehydrogenase from Calliphora with 62.56% of identity
• Blastx: Xanthine dehydrogenase from Calliphora with 62.56% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013465430.1)
• Pfam: Molybdopterin-binding domain of aldehyde dehydrogenase (PF02738.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;