Transcript | Ll_transcript_46071 |
---|---|
CDS coordinates | 2-643 (+) |
Peptide sequence | IEGECRIGGQEQFYLETQACLAVPKPEDGEMEVYSSTQNPTEVGKLIAEILGVQQNKIFCKVKRLGGGFGGKESKAAMLALPVCAAANKLNRPIRCMLDRDEDIIMTGARHPFKFTYKVAFDNKGKILGCDIQCYNNCGYAVDLSLSVLERAMTHFENAYSIPVVRVTGYPCKTNLPSNTAFRGFGGPQGMYAAECILQDIADYLKKDPFEISE |
ORF Type | internal |
Blastp | Xanthine dehydrogenase from Calliphora with 62.56% of identity |
---|---|
Blastx | Xanthine dehydrogenase from Calliphora with 62.56% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013465430.1) |
Pfam | Molybdopterin-binding domain of aldehyde dehydrogenase (PF02738.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer