Protein coding transcript 131708

• Transcript: Ll_transcript_45997
• CDS coordinates: 1-300 (+)
• Peptide sequence: KESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDS
• ORF Type: internal

Annotations of Ll_transcript_45997

• Blastp: 26S proteasome regulatory subunit 4 from Sophophora with 100% of identity
• Blastx: 26S proteasome regulatory subunit 4 from Sophophora with 100% of identity
• Eggnog: 26S protease regulatory subunit(COG1222)
• Kegg: Link to kegg annotations (Dmel_CG5289)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429586.1)
• Pfam: Protein of unknown function (DUF815) (PF05673.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;