Protein coding transcript 131713

• Transcript: Ll_transcript_46059
• CDS coordinates: 79-393 (+)
• Peptide sequence: MVNVPKQRRTYCKKCKVHKVHKVTQYKKSKERQASQGRRRYDRKQSGFGGQTKPIFRKKAKTTKKIVLRMECSECKYRKQIPLKRCKHFELGGDKKRKGQMIQF*
• ORF Type: complete

Annotations of Ll_transcript_46059

• Blastp: 60S ribosomal protein L44 from Protomacleaya with 94.23% of identity
• Blastx: 60S ribosomal protein L44 from Protomacleaya with 94.23% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014517837.1)
• Pfam: Ribosomal protein L44 (PF00935.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;