Transcript | Ll_transcript_183190 |
---|---|
CDS coordinates | 817-1554 (+) |
Peptide sequence | MLKKVKDPIIWILGFLKKLKDMQIPRPIKRHIDAIVNISSIDYGSSETSPSKEKAPVVITIPSVCELHSVGIRFEPSQDGIIAIEFDEKKGIFYLPLIKLDVNSEVIMRNLVAHEALTKPNFLIFTKYTELMREIIDSEKDVKILKESNIIKSNSSLGIKEIEQLFNGMSKSIGPTKTKELDGTINKVTKYYHEKRKANLYRNFTEYVYSSWKFFTLLSTFVLLAMTAIQTVCTAYDCSKVLKRT* |
ORF Type | complete |
Blastp | Putative UPF0481 protein At3g02645 from Arabidopsis with 46.34% of identity |
---|---|
Blastx | Putative UPF0481 protein At3g02645 from Arabidopsis with 46.34% of identity |
Eggnog | UPF0481 protein(ENOG410YDVR) |
Kegg | Link to kegg annotations (AT3G02645) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436829.1) |
Pfam | Plant protein of unknown function (PF03140.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer