Protein coding transcript 131731

• Transcript: Ll_transcript_183219
• CDS coordinates: 3-422 (-)
• Peptide sequence: MHYVNKTKIRKEVMAFKMDLEKAHDWVNWDFLHETLIKFGFSSITVKLIIWCVTSGEMSLLWNGSKLDGFKPNRVLHQGDLLLPYLFVLCVEKLAFFINKKVDLGLWHPIKLFRGGPPVSHLLFVEDILLFAKRRNPKSE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_183219

• Blastp: Uncharacterized mitochondrial protein AtMg01250 from Arabidopsis with 38.46% of identity
• Blastx: LINE-1 retrotransposable element ORF2 protein from Homo with 32.39% of identity
• Eggnog: Retrotransposon protein(ENOG410Y65V)
• Kegg: Link to kegg annotations (ArthMp102)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457635.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;