Protein coding transcript 131737

• Transcript: Ll_transcript_183235
• CDS coordinates: 128-592 (+)
• Peptide sequence: MASSKSGSGNVGIALERMSVEQLKAVKEQTDLEVNLLQDSLSNIRTATTRLEIATTALNDLSLRPQGKKMLVPLTASLYVPATLDDADNVLVDVGTGYFIEKTMAEGKDYCERKINLLKSNFDQLVEVASKKKNVADEVGIVLQAKLKQLSAST*
• ORF Type: complete

Annotations of Ll_transcript_183235

• Blastp: Probable prefoldin subunit 5 from Arabidopsis with 75.97% of identity
• Blastx: Probable prefoldin subunit 5 from Arabidopsis with 75.97% of identity
• Eggnog: Molecular chaperone capable of stabilizing a range of proteins. Seems to fulfill an ATP-independent, HSP70-like function in archaeal de novo protein folding (By similarity)(COG1730)
• Kegg: Link to kegg annotations (AT5G23290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441681.1)
• Pfam: Prefoldin subunit (PF02996.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;