Transcript | Ll_transcript_183234 |
---|---|
CDS coordinates | 2-451 (+) |
Peptide sequence | VNITKSEINLEKCSRSDTIFIRKHAQDIYVSIYESLEMTNNTVENVEAVYTTLALICIELLSEETVLDFIRLILSIQELAITNAVLSTQQKFHLHGLVISIMLLVAIVTDLHPLKDYVEKVIEQRKLLSATHLLPELSVHNEVKSSSLLP |
ORF Type | internal |
Blastp | Protein EFR3 homolog B from Mus with 38.93% of identity |
---|---|
Blastx | Protein EFR3 homolog B from Mus with 38.93% of identity |
Eggnog | EFR3 homolog(ENOG410YJSK) |
Kegg | Link to kegg annotations (668212) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425871.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer