| Transcript | Ll_transcript_183234 |
|---|---|
| CDS coordinates | 2-451 (+) |
| Peptide sequence | VNITKSEINLEKCSRSDTIFIRKHAQDIYVSIYESLEMTNNTVENVEAVYTTLALICIELLSEETVLDFIRLILSIQELAITNAVLSTQQKFHLHGLVISIMLLVAIVTDLHPLKDYVEKVIEQRKLLSATHLLPELSVHNEVKSSSLLP |
| ORF Type | internal |
| Blastp | Protein EFR3 homolog B from Mus with 38.93% of identity |
|---|---|
| Blastx | Protein EFR3 homolog B from Mus with 38.93% of identity |
| Eggnog | EFR3 homolog(ENOG410YJSK) |
| Kegg | Link to kegg annotations (668212) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425871.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer