Protein coding transcript 131746

• Transcript: Ll_transcript_183167
• CDS coordinates: 3-506 (+)
• Peptide sequence: YLELCVDLKKSHIAKEGLFQYRNMFQSVNVGSLENVIRGYLRSAEERTEAAREQSQQAVVDIDDLDNLATPESILLSAVSGEDAQDRSDRTILTPWVKFLWESYCQCLELLRTNAHVETLYHDIAKMAYQFCLKYNRKTEFRKLCDKLRKHLEDIAKLPPQTVNVSLS
• ORF Type: internal

Annotations of Ll_transcript_183167

• Blastp: Eukaryotic translation initiation factor 3 subunit A from Stegomyia with 83.33% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit A from Stegomyia with 83.33% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XQ37)
• Kegg: Link to kegg annotations (AaeL_AAEL007078)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016207648.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;