Transcript | Ll_transcript_95028 |
---|---|
CDS coordinates | 1-327 (-) |
Peptide sequence | MITHVLHMHVVLLHSSKQSTYATSFKSITYALPHLLFTEKDNHRSKIHVEAPPTASVPPSGDHQTPATGGSGGRVTGILRRWQMDDLLKKGSLAFRGAALVFSLISFIV |
ORF Type | 3prime_partial |
Blastp | CASP-like protein 4B1 from Arabidopsis with 38.89% of identity |
---|---|
Blastx | - |
Eggnog | CASP-like protein(ENOG410YJZ0) |
Kegg | Link to kegg annotations (AT2G38480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459677.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer