Protein coding transcript 131749

• Transcript: Ll_transcript_95075
• CDS coordinates: 376-1140 (+)
• Peptide sequence: MLFKEGPSSLYRGMASPLVASTLQNAMAFQSYTILTRAFDSCFAAKDTSSYKSVVLGGLGSGALQSFLISPVELVKIQVQLRDICGKNLSPYRSCKGPIRVAKDIWKNEGLVGIYRGLFITIIRDAPSHGVYFWTYEYMKEQLHPGCRKNCDEGLNTMLVAGGCAGVTSWIFCYPFDVVKTRLQAQTPSSLKYKDIVDCFAKIIREEGHGALWRGVETAVARAFVVNAAIFAAYEATLRIMFNNNKSNQMQDTI*
• ORF Type: complete

Annotations of Ll_transcript_95075

• Blastp: Mitochondrial arginine transporter BAC2 from Arabidopsis with 57.49% of identity
• Blastx: Mitochondrial arginine transporter BAC2 from Arabidopsis with 57.67% of identity
• Eggnog: carrier protein(ENOG410Z9ZS)
• Kegg: Link to kegg annotations (AT1G79900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418006.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;