| Transcript | Ll_transcript_95079 |
|---|---|
| CDS coordinates | 111-518 (+) |
| Peptide sequence | MSKPPSAFDALMSGARAAAKKKPPNSTTSSRKKRKSPPPPTPAPASTLNPSSNSKTLDSQDSVKHEPPQKKLRNVSNSSSQEKNAELRKLAPLLKKKPSEFKPSSVATWEKGDPVPFLFLSLAFDMISKESGRIVI |
| ORF Type | 3prime_partial |
| Blastp | DNA ligase 1 from Arabidopsis with 42.04% of identity |
|---|---|
| Blastx | DNA ligase 1 from Arabidopsis with 38.26% of identity |
| Eggnog | DNA ligase(COG1793) |
| Kegg | Link to kegg annotations (AT1G08130) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019465069.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer