| Transcript | Ll_transcript_95056 |
|---|---|
| CDS coordinates | 143-547 (+) |
| Peptide sequence | MSYFDEYHDHESFPSFNNDMGHTHFNKNILLIIAIVTLFVVFILVFAVYFYVRVFLRRQARRRIAIHHLRLNTAHAHAQAIEPHNKGLDPLLIKALPIFIFKRKEPHQQQLEDQSGDECAVCLSVLEDEEMNRG* |
| ORF Type | complete |
| Blastp | E3 ubiquitin-protein ligase ATL41 from Arabidopsis with 34.06% of identity |
|---|---|
| Blastx | - |
| Eggnog | zinc ion binding(ENOG41121N2) |
| Kegg | Link to kegg annotations (AT2G42360) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019432139.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer