Protein coding transcript 131754

• Transcript: Ll_transcript_95023
• CDS coordinates: 132-941 (+)
• Peptide sequence: MAFTLDRCEDNIVFTVDSQKSVPAPFLTKTYQLVDDPQTDNIVSWSDDETTFVVWRPSEFARDLLPNYFKHNNFSSFVRQLNTYGFKKVVADRWEFSNEYFRKGAKHLLCEIHRRKTPHHHQQHYHDQPQQFLQPDEGLCWIDTPLQSSKPSNDILTTLSEDNQRLRRKNYMLLSELTHMKNLYNDIIYFIQNHVNPAPFEQRSNIVIPKLVELDSLPQSPNVAAVIRPSKSGIMDKSLVNCSEDCNSSVKIFGVPLSGKKRVHSDNIG*
• ORF Type: complete

Annotations of Ll_transcript_95023

• Blastp: Heat stress transcription factor B-4 from Arabidopsis with 48.54% of identity
• Blastx: Heat stress transcription factor B-4b from Oryza sativa with 46.79% of identity
• Eggnog: Transcription factor(COG5169)
• Kegg: Link to kegg annotations (AT1G46264)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460439.1)
• Pfam: HSF-type DNA-binding (PF00447.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;