Protein coding transcript 131755

• Transcript: Ll_transcript_95011
• CDS coordinates: 3-308 (+)
• Peptide sequence: RDYLQQVVDGKLPVNHQIIYQLQEIFNLLPDVEKDTLVAAMHVKVNDHMLAVYLATTIRTIIALHNLINNKIANSDDEKKQLREPEEKKEEVAKKKEIKAK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_95011

• Blastp: 26S proteasome non-ATPase regulatory subunit 7 from Sophophora with 56.19% of identity
• Blastx: 26S proteasome non-ATPase regulatory subunit 7 from Sophophora with 64.47% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG1310)
• Kegg: Link to kegg annotations (Dmel_CG3416)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020988496.1)
• Pfam: Maintenance of mitochondrial structure and function (PF13012.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;