Protein coding transcript 131756

• Transcript: Ll_transcript_95012
• CDS coordinates: 1-429 (+)
• Peptide sequence: DKDKSVWFLDHDYLENMYGMFKKVNAREKVVGWYHTGPKLHQNDIAVNELVRQYCVNNTSVMVIVDVKPKDVGIPTEAYRVVEQIHDDGSPPSKTLEHIASEIGAEEAEEVGVEHLLRDIKDSTSGSLSQRVANIIFGARGLY
• ORF Type: internal

Annotations of Ll_transcript_95012

• Blastp: 26S proteasome non-ATPase regulatory subunit 7 from Sophophora with 79.58% of identity
• Blastx: 26S proteasome non-ATPase regulatory subunit 7 from Sophophora with 79.58% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG1310)
• Kegg: Link to kegg annotations (Dmel_CG3416)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003616580.1)
• Pfam: JAB1/Mov34/MPN/PAD-1 ubiquitin protease (PF01398.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;