Protein coding transcript 131764

• Transcript: Ll_transcript_95083
• CDS coordinates: 744-1280 (+)
• Peptide sequence: MLSEGSYVICLLATMIALDSSFIIGEGTIEGKFECGYLVSVKLGSEVLRGVLYHPDPSVPPAQVQQYENAVVPFSKNNKASSSGRRRKNKRRWDPNYPKPNRSGYNFYFAEKHYKLKELYPNREREFTKMIGHSWNCLSSEERMVYQNIGLKDKERYKREVKEYKEKMMVGQREAGCP*
• ORF Type: complete

Annotations of Ll_transcript_95083

• Blastp: High mobility group B protein 9 from Arabidopsis with 64.05% of identity
• Blastx: High mobility group B protein 9 from Arabidopsis with 69.93% of identity
• Eggnog: At rich interactive domain(ENOG410Y2AP)
• Kegg: Link to kegg annotations (AT1G76110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416659.1)
• Pfam: HMG-box domain (PF09011.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;