Transcript | Ll_transcript_176689 |
---|---|
CDS coordinates | 3-827 (+) |
Peptide sequence | GKLSNGQEIAVKRLSMNSGQGDTEFKNEVQLVAKLQHRNLVRLFGCSLEKKERLLVYEFVPNKSLDYFIFDPIKRVQLDWERRYKIIAGIAKGLLYLHEDSRLRIIHRDLKASNILLDEEMNPKISDFGMARLFVLDQTQGNTSRIVGTYGYMAPEYVTQGKFSVKSDVFSFGVLALEIVCGQKNSGFRDGEHVEDLLSFAWKKWKDGTASNLIDPTMSNGSSNEIMRCIHIGLLCVQENLSDRPTMASVVLMLNSYSTTLPVPLEPAFFMQSRG |
ORF Type | internal |
Blastp | Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 66.18% of identity |
---|---|
Blastx | Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 66.18% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G23180) |
CantataDB | Link to cantataDB annotations (CNT0002981) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427246.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer