Protein coding transcript 131784

• Transcript: Ll_transcript_176599
• CDS coordinates: 182-775 (+)
• Peptide sequence: MDLSRVRMALESKSYDKIADICDNLMLQVAADGIAYEEEWPYALHLLSHFYVNDINSARFLWKSIPSSIKESQPEVAAVWKIGQRLWLRDYTGVHEAIHGFDWSEDLQDLVAAFSEIYTRKMFQLLLSAYSTISIHDTASFLGMSEDDATNYVLQQGWTVDHASQMLTVKKQAIVTEQKLDPSKLQRLTEYVFHLEH*
• ORF Type: complete

Annotations of Ll_transcript_176599

• Blastp: COP9 signalosome complex subunit 8 from Arabidopsis with 70.05% of identity
• Blastx: COP9 signalosome complex subunit 8 from Arabidopsis with 70.05% of identity
• Eggnog: cullin deneddylation(ENOG410XW9N)
• Kegg: Link to kegg annotations (AT4G14110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440397.1)
• Pfam: CSN8/PSMD8/EIF3K family (PF10075.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;