Protein coding transcript 131785

• Transcript: Ll_transcript_176663
• CDS coordinates: 1-474 (+)
• Peptide sequence: SSPVFSFYLNRNPDAPSGGEMIMGGSDPKKYKGDFTYIPVSRQAYWQFKMDSLKIGSKGFCNNGCQAIADTGTSLIAGPVEEIAAINKAIGATPLAAGECMVDCNLIPNLPKIDFVLGGKSFTLEGKDYILRISQMGKTMCLSGFMGIDIPPPNGPLW
• ORF Type: internal

Annotations of Ll_transcript_176663

• Blastp: Lysosomal aspartic protease from Stegomyia with 76.43% of identity
• Blastx: Lysosomal aspartic protease from Stegomyia with 76.43% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AaeL_AAEL006169)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429923.1)
• Pfam: Eukaryotic aspartyl protease (PF00026.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;