Protein coding transcript 131786

• Transcript: Ll_transcript_176664
• CDS coordinates: 78-542 (+)
• Peptide sequence: MIRSIILCSLLFSFVFGDSTTNFVRVPLEKFKSVRRTLEDVGTQVKQVQLRYTAGGPTPEPLSNYLDAQYYGAISIGNPPQKFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSSKSSSYKKNGTNFAIQYGSGSLSGFLSTDVVNVGGLDVK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_176664

• Blastp: Lysosomal aspartic protease from Stegomyia with 63.23% of identity
• Blastx: Lysosomal aspartic protease from Stegomyia with 63.23% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AaeL_AAEL006169)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015959064.1)
• Pfam: A1 Propeptide (PF07966.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;