Protein coding transcript 131792

• Transcript: Ll_transcript_194875
• CDS coordinates: 2-307 (+)
• Peptide sequence: FIKKCKKFWDDVHKAELNVKFELVSGVPGCGKTTYIMNEHGEKDLVLSATKEGASEFRKRARDASLPLVSERYKTVCSYLYNNFNEYDTVYLDEAMMVHPGT
• ORF Type: internal

Annotations of Ll_transcript_194875

• Blastp: Replicase large subunit from Tobamovirus with 40.45% of identity
• Blastx: Replicase large subunit from Tobamovirus with 40.45% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (1724827)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443314.1)
• Pfam: Viral (Superfamily 1) RNA helicase (PF01443.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;