Transcript | Ll_transcript_194893 |
---|---|
CDS coordinates | 223-522 (+) |
Peptide sequence | MNNEMDDFAKVFSCGWSWKENKLFEQALTEVDENHPERWEVVAAMVGGEKSARDVEKHYVILLKDLELIESGELDHELGEVQPFVLVDHITKSLCLPGK* |
ORF Type | complete |
Blastp | Protein RADIALIS-like 3 from Arabidopsis with 52.46% of identity |
---|---|
Blastx | Protein RADIALIS-like 3 from Arabidopsis with 52.46% of identity |
Eggnog | Transcription factor(COG5269) |
Kegg | Link to kegg annotations (AT4G36570) |
CantataDB | Link to cantataDB annotations (CNT0002451) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014495355.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer