| Transcript | Ll_transcript_194893 |
|---|---|
| CDS coordinates | 223-522 (+) |
| Peptide sequence | MNNEMDDFAKVFSCGWSWKENKLFEQALTEVDENHPERWEVVAAMVGGEKSARDVEKHYVILLKDLELIESGELDHELGEVQPFVLVDHITKSLCLPGK* |
| ORF Type | complete |
| Blastp | Protein RADIALIS-like 3 from Arabidopsis with 52.46% of identity |
|---|---|
| Blastx | Protein RADIALIS-like 3 from Arabidopsis with 52.46% of identity |
| Eggnog | Transcription factor(COG5269) |
| Kegg | Link to kegg annotations (AT4G36570) |
| CantataDB | Link to cantataDB annotations (CNT0002451) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014495355.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer