Protein coding transcript 131800

• Transcript: Ll_transcript_194890
• CDS coordinates: 117-536 (+)
• Peptide sequence: MEKLACLLVLASLAGLSAATTACSNPEVTATSYTSPDATVLTSIAFVAEFSLKCGNGVQNPALYAELNGKTQPVARIGPNKYQVSWAEDTKKARRGDYTINIYDEDNFAAVRKAMRNNEDISTVKALATVVLNYPGSYQG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_194890

• Blastp: Translocon-associated protein subunit delta from Bos with 44.26% of identity
• Blastx: Translocon-associated protein subunit delta from Bos with 44.07% of identity
• Eggnog: Signal sequence receptor delta(ENOG4111GCB)
• Kegg: Link to kegg annotations (504438)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: Translocon-associated protein, delta subunit precursor (TRAP-delta) (PF05404.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;