Protein coding transcript 131808

• Transcript: Ll_transcript_194819
• CDS coordinates: 3-728 (+)
• Peptide sequence: NNEKYQIFWNQFGLVLKEGPAEDHENLNKIANLLRFTSMKSNNSEQKMSLKEYISNMNEQQEKIYYITADSYSSANNSPHLELFKKNNIDVLLLSDRIDEWMMNYLSEFEGKKFQSISKEDISLNKLTKEKKIKNKDVSTEMIEFLKKVKNILGNQVKDVRLTHRLTETPCVLLSDSTEMTTQMAKLFSAAGQSVPELKYIFEINPDHILIKKICTINNENELHQWIKLLLDQALLAEKGNL
• ORF Type: internal

Annotations of Ll_transcript_194819

• Blastp: Chaperone protein HtpG from Buchnera with 100% of identity
• Blastx: Chaperone protein HtpG from Buchnera with 100% of identity
• Eggnog: Molecular chaperone. Has ATPase activity (By similarity)(COG0326)
• Kegg: Link to kegg annotations (BU483)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003617951.1)
• Pfam: Hsp90 protein (PF00183.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;