Protein coding transcript 131812

• Transcript: Ll_transcript_194900
• CDS coordinates: 3-632 (+)
• Peptide sequence: TPNRTGRQCEFVFGSTMLGVKLCGAVALCGLLAILDVSQAFRTVCYYEGKAMWRKDVVKVGAEELKPALSYCTHLVYGYAGIDDDKFKAKSLDPKLDLPESKDVKGGKGNFKAITALKKIYPSLTILLSVGGNADVEDPDKYLTALETPKSRTQFASTISAMAKENGFDGVDLAWQFPVVTEKKEKNTWGSFIHKVAKTVGITSKDSKEA
• ORF Type: internal

Annotations of Ll_transcript_194900

• Blastp: Chitinase-like protein EN03 from Bombyx with 46.75% of identity
• Blastx: Chitinase-like protein EN03 from Bombyx with 46.75% of identity
• Eggnog: chitinase(COG3325)
• Kegg: Link to kegg annotations (692387)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016178002.2)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;