Protein coding transcript 131820

• Transcript: Ll_transcript_217017
• CDS coordinates: 22-777 (+)
• Peptide sequence: MHRTMAKAQALFILLVSFSLCVFSLELDTALPHSPPLSAHALPPHHHHSPLRHSPAHPPYHRRYHHHSHAPANSPTHNHPQTPGPAKPRTNHIYTNIRTLANPPTRHIYTPAPVQVDPRPPVHPIPTRFVAIEGHVFTKSCSHLGNDTIKGGYPTPGAIVKLECNNRSIVQETVTNRNGYFLIYVVRSITIDTIHNCKVYLVSAPKGLKITDHNGGIRGVTLSPQHRTVHWNYLFNLYRIGGFAVEHICKN*
• ORF Type: complete

Annotations of Ll_transcript_217017

• Blastp: Non-classical arabinogalactan protein 30 from Arabidopsis with 31.01% of identity
• Blastx: Non-classical arabinogalactan protein 30 from Arabidopsis with 31.01% of identity
• Eggnog: Pollen proteins Ole e I like(ENOG410Z3GS)
• Kegg: Link to kegg annotations (AT2G33790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425267.1)
• Pfam: Pollen proteins Ole e I like (PF01190.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;