Protein coding transcript 131821

• Transcript: Ll_transcript_216992
• CDS coordinates: 29-625 (-)
• Peptide sequence: MRNGNNNTSASSSGASETGRHPLYRGVRRRSSGKWVSEIREPKKPNRIWLGTFPTAEMAAVAYDVAALALKGKNAELNFPNSASSLPVPASSAARDIQMAAASAAAAIGAAKDALSGGEGSRGGDVSVSQEINMASGNGFVDEDLIFDMPNVLVNMAEGMLLSPPRFDVGGSEYVDYSTQENIGEDPNLWSFPYFQYP*
• ORF Type: complete

Annotations of Ll_transcript_216992

• Blastp: Ethylene-responsive transcription factor ERF024 from Arabidopsis with 61.88% of identity
• Blastx: Ethylene-responsive transcription factor ERF024 from Arabidopsis with 55.25% of identity
• Eggnog: Transcription factor(ENOG410YQRF)
• Kegg: Link to kegg annotations (AT2G36450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425202.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;