Protein coding transcript 131823

• Transcript: Ll_transcript_217057
• CDS coordinates: 2-637 (+)
• Peptide sequence: AEKRKGKKRKDDYMSKDEVVEKPSKDEINVANWLKKNVPIKKTKFLSHNVIYFTGKRAVDALVESKFYNEEDGLFKSRDQIVNFMDLMLSHKFYHRARKVPISDAELKAKRKDKKEAKDSEDDKNRDGKGTDAESSVVESKQDKEVSKEKKKKKIRLEMHNDQRFVDSLDAYVWIYDTIPLYYWVIGAFFFFFCVGLCLFPLSPESVRLLVS
• ORF Type: internal

Annotations of Ll_transcript_217057

• Blastp: Translocation protein SEC62 from Mus with 29.57% of identity
• Blastx: Translocation protein SEC62 from Homo with 38.83% of identity
• Eggnog: translocation protein(COG5232)
• Kegg: Link to kegg annotations (69276)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020224790.1)
• Pfam: Translocation protein Sec62 (PF03839.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;