Protein coding transcript 131824

• Transcript: Ll_transcript_217058
• CDS coordinates: 268-942 (+)
• Peptide sequence: MVLLLATLFLTVLFIAGLINMFFCIPYSNKICSWLRIFLPNNANCKTNFTAASGTTSQAKKVERDAFKKGELRKVFSTFDKNNDGFITKKELREALRNFMTDSEIDDTFVKFDSNGDGFIDFDEFCLLTSESIMSNEKEGIIGNEGEEEVNLKEAFDVFDKDKDGLISVEELALVLTSLGLREGKKIEECKEMIRKVDMDGDDMVNFNEFKRMMMNRGNLVFAA*
• ORF Type: complete

Annotations of Ll_transcript_217058

• Blastp: Probable calcium-binding protein CML28 from Oryza sativa with 46.75% of identity
• Blastx: Calmodulin-like protein 7 from Arabidopsis with 48.34% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440475.1)
• Pfam: Secreted protein acidic and rich in cysteine Ca binding region (PF10591.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;