Protein coding transcript 131828

• Transcript: Ll_transcript_217022
• CDS coordinates: 122-460 (-)
• Peptide sequence: ADTGLQRSVTSFRRQGSSGLVWDDKFIQNLNLIQNQNEENQREENSEGTSYTLERNRSVGARPYRTVNVAEPSIDPPSPKVATCGLCGFFWKKKPVNEIRTHKSIPMSRKRR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_217022

• Blastp: Uncharacterized protein At1g15400 from Arabidopsis with 37.3% of identity
• Blastx: MAPK kinase substrate protein At1g80180 from Arabidopsis with 32.61% of identity
• Eggnog: NA(ENOG410ZGQ8)
• Kegg: Link to kegg annotations (AT1G15400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452808.1)
• Pfam: Domain of unknown function (DUF4666) (PF15697.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;