Transcript | Ll_transcript_217075 |
---|---|
CDS coordinates | 120-530 (+) |
Peptide sequence | MDYSLAALKLLCSQLKDVGEVASQNSFTLGGILFQRVWLQGVLVSSSDGDDVPLLLDDGTGLIQLHLSGDFRHRHWELGMYVMVVGGYVIRTGEPPMLKVHKIVDLSSSPDREAMWYLEVIEAYKLFYQPLVEEFT* |
ORF Type | complete |
Blastp | RecQ-mediated genome instability protein 2 from Gallus with 32.56% of identity |
---|---|
Blastx | - |
Eggnog | RMI2, RecQ mediated genome instability 2, homolog (S. cerevisiae)(ENOG41120UE) |
Kegg | Link to kegg annotations (416628) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450476.1) |
Pfam | RecQ-mediated genome instability protein 2 (PF16100.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer